ELISA Recombinant Salmonella typhimurium Oligopeptide transport system permease protein oppB(oppB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Uniprot NO.:P08005 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGERALPPEVLANIEAKYHLNDPIM TQYFSYLKQLAHGDFGPSFKYKDYTVNDLVAASFPVSAKLGAAAFLLAVIIGVSAGVIAA LKQNTRWDYTVMGFAMTGVVIPSFVVAPLLVMVFAITLQWLPGGGWNGGALKFMILPMVA LSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIIFRHALKPALLPVLSYMGPAF VGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVI DPKIRY Protein Names:Recommended name: Oligopeptide transport system permease protein oppB Gene Names:Name:oppB Ordered Locus Names:STM1745 Expression Region:1-306 Sequence Info:fµLl length protein