ELISA Recombinant Streptococcus pneumoniae Glycerol uptake facilitator protein(glpF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6) Uniprot NO.:P0A3Q8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMNELFGEFLGTLILILLGNGVVAGVVLPKTKSNSSGWIVITMGWGIAVAVAVFVSGKLS PAHLNPAVTIGVALKGGLPWASVLPYILAQFAGAmLGQILVWLQFKPHYEAEENAGNILA TFSTGPAIKDTVSNLISEILGTFVLVLTIFALGLYDFQAGIGTFAVGTLIVGIGLSLGGT TGYALNPARDLGPRIMHSILPIPNKGDGDWSYAWIPVVGPVIGAALAVLVFSLF Protein Names:Recommended name: Glycerol uptake facilitator protein Gene Names:Name:glpF Ordered Locus Names:spr1988 Expression Region:1-234 Sequence Info:fµLl length protein