ELISA Recombinant Pisum sativum Chlorophyll a-b binding protein AB96(AB96)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pisum sativum (Garden pea) Uniprot NO.:P04159 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHSRWAmLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSI LAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNG RLAMFSMFGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK Protein Names:Recommended name: Chlorophyll a-b binding protein AB96 Alternative name(s): LHCII type I CAB-AB96 Short name= LHCP Major 15 Gene Names:Name:AB96 Expression Region:1-228 Sequence Info:fµLl length protein