ELISA Recombinant Wheat dwarf virus Movement protein (V2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Wheat dwarf virus (isolate Sweden) (WDV) Uniprot NO.:P06849 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEQAIAPPLPIRDYQYQTPSIPGSSDYAWRTFVFVTFGLLIAVGVAWLAYTLFLKDLILV CKAKKQRRTEEIGYGNTPARLNGDQQGLPR Protein Names:Recommended name: Movement protein Short name= MP Gene Names:ORF Names:V2 Expression Region:1-90 Sequence Info:fµLl length protein