ELISA Recombinant Vaccinia virus Envelope protein H3 (VACWR101)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Uniprot NO.:P07240 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAAKTPVIVVPVIDRLPSETFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYK DYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEY VVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHAIFTYTGG YDVSLSAYIIRVTTELNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHD PRLVAEHRFENMKPNFWSRIGTAATKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFIM FmLIFNVKSKLLWFLTGTFVTAFI Protein Names:Recommended name: Envelope protein H3 Alternative name(s): Ag35 Virion envelope protein p35 Gene Names:Ordered Locus Names:VACWR101 ORF Names:H3L Expression Region:1-324 Sequence Info:fµLl length protein