ELISA Recombinant Pseudomonas phage phi6 Major envelope protein(P9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas phage phi6 (Bacteriophage phi-6) Uniprot NO.:P07581 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPFPLVKQDPTSKAFTEASERSTGTQILDVVKAPIGLFGDDAKHEFVTRQEQAVSVVSWA VAAGLIGELIGYRGARSGRKAILANIPFLA Protein Names:Recommended name: Major envelope protein Alternative name(s): Protein P9 Gene Names:Name:P9 Expression Region:1-90 Sequence Info:fµLl length protein