ELISA Recombinant Vaccinia virus Protein L1 (VACWR088)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Uniprot NO.:P07612
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAG TGVQFYMIVIGVIILAALFMYYAKRmLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDMQN
Protein Names:Recommended name: Protein L1 Alternative name(s): Virion membrane protein M25
Gene Names:Ordered Locus Names:VACWR088 ORF Names:L1R
Expression Region:2-250
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.