ELISA Recombinant Synechococcus sp. ATP synthase protein I(atpI)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAµg 1402/1) (Anacystis nidµLans) Uniprot NO.:P08443 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRmLGKAVERIG ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS Protein Names:Recommended name: ATP synthase protein I Gene Names:Name:atpI Synonyms:atp1 Ordered Locus Names:syc1183_c Expression Region:1-118 Sequence Info:fµLl length protein