ELISA Recombinant Varicella-zoster virus Virion egress protein 24(24)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Varicella-zoster virus (strain Dumas) (HHV-3) ( herpesvirus 3) Uniprot NO.:P09280 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSRRTYVRSERRRGCGDNLLQRIRLVVPSALQCCDGDLPIFDPQRPPARCVFQFNGEDNV SEAFPVEYIMRLMANWAQVDCDPYIKIQNTGVSVLFQGFFFRPTNAPVAEVSIDSNNVIL SSTLSTGINLSALESIKRGGGIDRRPLQALMWVNCFVRMPYVQLSFRFMGPEDPSRTIKL MARATDAYMYKETGNNLDEYIRWRPSFRSPPENGSPNTSVQMQSDIKPALPDTQTTRVWK LALPVANVTYALFIVIVLVVVLGAVLFWK Protein Names:Recommended name: Virion egress protein 24 Alternative name(s): Primary envelopment factor 24 Gene Names:Name:24 Expression Region:1-269 Sequence Info:fµLl length protein