ELISA Recombinant Salmonella typhimurium Peptide transport system permease protein sapB(sapB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Uniprot NO.:P0A2J3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIIFTLRRLLLLLVTLFFLTFIGFSLSYFTPHAPLQGASLWNAWVFWFNGLLHWDFGVSS INGQLISEQLKEVFPATMELCILAFGFALMVGIPVGmLAGVTRSKWPDRFISALALLGFS IPVFWLALLLTLFFSLTLGWLPVSGRFDLLYEVKPVTGFAIIDAWISDSPWRDEMVMSAI RHMVLPVLTLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPP VIPRLGLQFSTmLTLAMITEMVFSWPGLGRWLIHAIRQQDYAAISAGVMVIGSLVIVVNV ISDILGAMANPLKHKEWYALR Protein Names:Recommended name: Peptide transport system permease protein sapB Gene Names:Name:sapB Ordered Locus Names:STM1693 Expression Region:1-321 Sequence Info:fµLl length protein