Skip to Content

ELISA Recombinant Streptomyces coelicolor Sensor protein CutS(cutS)

https://www.anagnostics.com/web/image/product.template/159160/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:P0A4I7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATTPAPPGAPPKPTWDPRSATPLPWLRPTIRIRLTLLYGGMFLIAGILLLSIIYLLAAQ AVRTGNEPLYKIVDFTDLKVSSSTCPVVDNGGLSLSDFNAAISDCMDHQRKVALDNLLSR SLLALLGLAVIAFAFGYAMAGRVLSPLGRITRTARAVAGSDLSRRIELDGPDDELKELAD TFDDmLERLQRAFTAQQRFVGNASHELRTPLAINRTLLEVHLSDPGAPVELQQLGKTLLA TNERSELLVEGLLLLARSDNQIVERKPVDLAEVAGQAIDQVHAEAESKGVEVRGTREAAV VQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNL FEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGGGLVMRVTLPV Protein Names:Recommended name: Sensor protein CutS EC= 2.7.13.3 Gene Names:Name:cutS Ordered Locus Names:SCO5863 ORF Names:SC2E9.04 Expression Region:1-414 Sequence Info:fµLl length protein

1,772.00 € 1772.0 EUR 1,772.00 €

1,772.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.