ELISA Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF301

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas phage Pf3 (Bacteriophage Pf3) Uniprot NO.:P03626 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MITLITAVPGSGKTLYAIGLIEAALSEGRPVFTNISGLVKDKFSNPHLLSDAPDDWRDTP EGSLVVYDEAQQAHLYPSNAQRGPVTDERLTAMETHRHTGHDLVFITQAPTFVHHHIRKL VGLHIHLYRSRGLQAASKYEWSHVCDSPNDRKEQQRADFVLWKFPKEHFAFYTSAVMHTH KFKMPKKIGVLLVFVVLGLGAVGFNLYKNSGLASMAEATASVAEATPSPLALNGVKPSSL AAPYQWSAAAPAVPVSGCVANRSTNRCQCFDASGVVLAIEHAACLSVISSPLPRQLLSTS K Protein Names:Recommended name: Putative assembly protein ORF301 Alternative name(s): ORF301 Gene Names: Expression Region:1-301 Sequence Info:fµLl length protein