ELISA Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 2a(GP2a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV) Uniprot NO.:A0MD30 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LGSPSQDGYWSFFSEWFAPRFSVRALPFTLPNYRRSYESLLPNCRPDVPQFAFKHPLGIL WHMRVSHLIDEMVSRRIYQTMEHSGQAAWKYVVGEATLTKLSKLDIVTHFQHLAAVEADS CRFLSSRLVmLKNLAVGNVSLQYNTTLDRVELIFPTPGTRPKLTDFRQWLISVHASIFSS VASSVTLFIVLWLRIPALRYVFGFHWPTATHHSS Protein Names:Recommended name: Glycoprotein 2a Short name= Protein GP2a Alternative name(s): GP2 Gene Names:Name:GP2a ORF Names:2a Expression Region:36-249 Sequence Info:fµLl length protein