ELISA Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 5(GP5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV) Uniprot NO.:A0MD34 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DGNGNNSTYQYIYNLTICELNGTNWLSGHFEWAVETFVLYPVVTHILSLGFLTTSHFFDA LGLGAVSTAGFVGGRYVLSSVYGACAFAAFVCFVIRAAKNCMACRYARTRFTNFIVDDRG GVHRWKSPIVVEKLGKAEIGGNLVTIKHVVLEGVKAQPLTRTSAEQWEA Protein Names:Recommended name: Glycoprotein 5 Short name= Protein GP5 Alternative name(s): G(L) Gene Names:Name:GP5 ORF Names:5 Expression Region:33-201 Sequence Info:fµLl length protein