ELISA Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2(nuoK2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Uniprot NO.:A0LJM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVPFGHVLLLAGALFGLGVFCAVARRNLIMIVLGVEImLNAASIAFIGAAARWQSMEGQ AFVLFILAVAATEVSIGLAIIVYAFRRTGSFDPAAYNLMKAGDAMQSFERRGPQ Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 2 NDH-1 subunit K 2 Gene Names:Name:nuoK2 Ordered Locus Names:Sfum_1938 Expression Region:1-114 Sequence Info:fµLl length protein