Skip to Content

ELISA Recombinant Porcine reproductive and respiratory syndrome virus Membrane protein(M)

https://www.anagnostics.com/web/image/product.template/150328/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV) Uniprot NO.:A0MD35 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGGLDNFCNDPTAAQKIVLAFSITYTPIMIYALKVSRGRLLGLLHILIFLNCSFTFGYMT YVHFHSTHRVALTLGAVVALLWGVYSLTESWKFITSRCRLCCLGRRYILAPAHHVESAAG LHSISASGNRAYAVRKPGLTSVNGTLVPGLRSLVLGGKRAVKRGVVNLVKYGR Protein Names:Recommended name: Membrane protein Short name= Protein M Gene Names:Name:M ORF Names:6 Expression Region:1-173 Sequence Info:fµLl length protein

1,518.00 € 1518.0 EUR 1,518.00 €

1,518.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.