ELISA Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B UPF0442 protein YE0625 (YE0625)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) Uniprot NO.:A1JJF0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVMSLLWALLQDMVLAAIPALGFAMVFNVPMRALRYCALLGALGHGSRmLMIHFGMDIEP ASLLASIMIGMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEVL MSTMVTNFLKASFIVGSLSIGLSLPGLWLYRKRPGV Protein Names:Recommended name: UPF0442 protein YE0625 Gene Names:Ordered Locus Names:YE0625 Expression Region:1-156 Sequence Info:fµLl length protein