Skip to Content

ELISA Recombinant Agrostis stolonifera Photosystem II reaction center protein H(psbH)

https://www.anagnostics.com/web/image/product.template/115888/image_1920?unique=7f7b80c
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Agrostis stolonifera (Creeping bentgrass) Uniprot NO.:A1EA37 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ATQTVEDSSKPRPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIY NSSVLLDGILTN Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein Gene Names:Name:psbH Expression Region:2-73 Sequence Info:fµLl length protein

1,411.00 € 1411.0 EUR 1,411.00 €

1,411.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.