ELISA Recombinant Shewanella sp. UPF0114 protein Sputw3181_3501 (Sputw3181_3501)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shewanella sp. (strain W3-18-1) Uniprot NO.:A1RNR8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHVLPIIFEMREVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMNVENISNDKIMWYLLIHITFVLSAFAMGYLDKITRK Protein Names:Recommended name: UPF0114 protein Sputw3181_3501 Gene Names:Ordered Locus Names:Sputw3181_3501 Expression Region:1-162 Sequence Info:fµLl length protein