Skip to Content

ELISA Recombinant Shewanella amazonensis Membrane protein insertase YidC(yidC)

https://www.anagnostics.com/web/image/product.template/156817/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) Uniprot NO.:A1S1G5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESQRNLLLIGLLFVSFLLWQQWESDKAPKPATEVTAAAQIHDQAINSDVPTADAGVPAT VAATQNLILVTTDQLEIQINPVGGDIVHAALLTHKLEQNEEAPFVLLEQKNNFSYIAQSG LIGRDGIDSAASGRAKFAAAADAYTLADGQDTLEVPLTLTTDAGVTFTKVFVFKRGQFDV GVDYRVANNSAAPVQVQMYGQIKQTITASESSMMMPTYRGAAFSTADVRYEKYSFDDMGK KDLEEPTLGGWVAmLQHYFVSAWVPAAADKNTLFTSVSAGGLANIGFKGSVHDVAPGATE TISATFYVGPKDQAALSALSDTLNLVVDYGFLWWLAVPIHWILMFFQSLVHNWGVAIILV TLTVRGLLYPLTKAQYVSMAKMRNLQPKLQDLKDRFGDDRQKMGQAMMELYKKEKVNPMG GCLPILLQMPIFIALYWVLLESVELRHAPFmLWIQDLSVQDPYYVLPLLMGASMWAMQKM QPMAPNMDPMQQKmLQWMPMIFTVFFLWFPAGLVLYWLVGNLVAITQQKIIYASLEKKGL K Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC Gene Names:Name:yidC Ordered Locus Names:Sama_0009 Expression Region:1-541 Sequence Info:fµLl length protein

1,906.00 € 1906.0 EUR 1,906.00 €

1,906.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.