ELISA Recombinant Shewanella amazonensis Electron transport complex protein RnfA(rnfA)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Uniprot NO.:A1S6M9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSGKLESAIGMSMATTFVLTLASVLSFLVN QYLLAPFDLTYLRTMSFILVIAVVVQFTEmLVQKTSASLHRALGIYLPLITTNCAVLGVA LLNVNEQHDFLESAIYGFGAAVGFSLVLILFSAMRERLAAADVPMPFRGGAIAMITAGLM SLAFMGFTGLVK
Protein Names:Recommended name: Electron transport complex protein RnfA
Gene Names:Name:rnfA Ordered Locus Names:Sama_1830
Expression Region:1-192
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.