ELISA Recombinant Psychromonas ingrahamii Probable intracellular septation protein A (Ping_1054)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Psychromonas ingrahamii (strain 37)
Uniprot NO.:A1STS8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQFFEFIPLIIFFVVFKTTDIYIATGALIVSMGLmLAFNYYKDGKVEKMQVITFGMVLV FGTLTIVLHDDVFIKWKVTVVYALFSLALLVSQFFYKKPIIKQmLSKEINLPANIWNNLN MAWALLFAVLSAVNVYVAFSLSQETWVNFKVFGLLAITLAFTLLSGLYIYKYLPATAEKK ISANKNPEE
Protein Names:Recommended name: Probable intracellµLar septation protein A
Gene Names:Ordered Locus Names:Ping_1054
Expression Region:1-189
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.