ELISA Recombinant Pyrobaculum islandicum UPF0290 protein Pisl_0708 (Pisl_0708)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:PyrobacµLum islandicum (strain DSM 4184 / JCM 9189) Uniprot NO.:A1RSF4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLLYFFLLIWPPYVANGSAVLANKFKIRHPIDFGKTFVDGRRIFGDGKTYEGFLIGLST GTFIGYAPNLLYKHLSLLDAFVLSIAALLGDLFGAFIKRRLCMPRGYPAFPLDQLDFLLT SLAVYTLYKDISVEYIIAAVIITPLIHRITNYIAYYLRLKKEPW Protein Names:Recommended name: UPF0290 protein Pisl_0708 Gene Names:Ordered Locus Names:Pisl_0708 Expression Region:1-164 Sequence Info:fµLl length protein