ELISA Recombinant Verminephrobacter eiseniae UPF0060 membrane protein Veis_0342 (Veis_0342)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Verminephrobacter eiseniae (strain EF01-2) Uniprot NO.:A1WES5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELLKATVLFTITAVVEIVGCYLPWLVIKQNKPLWLLLPAALSLALFAWLLTLHPSAAGR TYAAYGGIYIAVALAWLHWVDGVSLTRWDVAGATVAMVGmLIImLQPASA Protein Names:Recommended name: UPF0060 membrane protein Veis_0342 Gene Names:Ordered Locus Names:Veis_0342 Expression Region:1-110 Sequence Info:fµLl length protein