ELISA Recombinant Polaromonas naphthalenivorans UPF0391 membrane protein Pnap_0032 (Pnap_0032)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Polaromonas naphthalenivorans (strain CJ2) Uniprot NO.:A1VI80 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIKYAIIFAVISLIAGALGFSGVAAGAAGIAKVLFGLFLILAVIFIVLAALGVGAAKKMM K Protein Names:Recommended name: UPF0391 membrane protein Pnap_0032 Gene Names:Ordered Locus Names:Pnap_0032 Expression Region:1-61 Sequence Info:fµLl length protein