ELISA Recombinant Ranunculus macranthus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:RanuncµLus macranthus (Large buttercup) Uniprot NO.:A1XGT8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLPGPIHDFLLVFLGLGFIMGGLGVVLLTNPIFSAFSLGLVLVCTSLFYTPSNSHFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYSDFHLWTVGDGVTSLVCTSIFVSLITTIPDTSW YGIVWTTRSNQIIEQDLINNSQQIGIHLSTDFFLPFELISIILLVALIGAISMARQY Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 6 NADH-plastoquinone oxidoreductase subunit 6 Gene Names:Name:ndhG Expression Region:1-177 Sequence Info:fµLl length protein