ELISA Recombinant Scheffersomyces stipitis Assembly factor CBP4(CBP4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) Uniprot NO.:A3LQD9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAKPLWYRWARVYFAGSCIIGTGVLCFIYTTPTDEQLIASFSPEIREDYEKNKAYRQRE QQELMEIVKKTSQSDEPVWKTGPIGSPLEKEQRNLNQQLIDYNQFEKKRAEEYQREQIDK AQEELLEVEKLAAQAKKGYWWNPFSSK Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA-processing protein 4 Gene Names:Name:CBP4 ORF Names:PICST_55406 Expression Region:1-147 Sequence Info:fµLl length protein