ELISA Recombinant Scheffersomyces stipitis Assembly factor CBP4(CBP4)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Uniprot NO.:A3LQD9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAKPLWYRWARVYFAGSCIIGTGVLCFIYTTPTDEQLIASFSPEIREDYEKNKAYRQRE QQELMEIVKKTSQSDEPVWKTGPIGSPLEKEQRNLNQQLIDYNQFEKKRAEEYQREQIDK AQEELLEVEKLAAQAKKGYWWNPFSSK
Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA-processing protein 4
Gene Names:Name:CBP4 ORF Names:PICST_55406
Expression Region:1-147
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.