ELISA Recombinant Staphylothermus marinus UPF0290 protein Smar_0617 (Smar_0617)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) Uniprot NO.:A3DM64 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGYMISPEYYFIYWFLKYYLSPMIANASPVLVKGIHRIDFSHIFIDGKPLFGKNKTWEG FYVGVLMGFLTSIGIGIILCEEEYILIGLGSSIFALIGDLLGSFIKRRMNIASGEPLPII DQLDFALMATLYYYFLGIEEFISYPLYILYSLIIILALHIITNNIAYYLGVKDKRW Protein Names:Recommended name: UPF0290 protein Smar_0617 Gene Names:Ordered Locus Names:Smar_0617 Expression Region:1-176 Sequence Info:fµLl length protein