Skip to Content

ELISA Recombinant Scheffersomyces stipitis Mitochondrial genome required protein 1(MGR1)

https://www.anagnostics.com/web/image/product.template/156088/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) Uniprot NO.:A3LN78 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVYIPPPNDNDSDKDKKKNKNNDNPNLNPEPSGDSKKVNNVIKGVSSTSPPGTTTYYIP NPSTWIPHNPSAGLIWGPLTPSSDNRPALYGMVGLQFILGLGFFRAARQLYRPRTIVTSV NSIPQHFTPKGSFWKASIPALTGAVAIYGCGLELSRLmLAYDPWYEEAKYYRRVAIKNGD KPSAWFGAYDYYKPMSTKAWIDKVGIWIKATEHELSEKQEVLDVSIVQANSSNPDDKGHV EHVLIPVKKNNLMSQMNKKGKYVEIYNRLRESNKSRYRTLLDTDLKDVQELNKAERIDLI LEGKSPYSNPEYTKPHIQLGNHHVDTDDEFEMVWLNFEPWDELKLETDYDIRLIPHWRWA DSDNSEPELDAVEQQHNHSISEAESSKELV Protein Names:Recommended name: Mitochondrial genome required protein 1 Gene Names:Name:MGR1 ORF Names:PICST_40521 Expression Region:1-390 Sequence Info:fµLl length protein

1,747.00 € 1747.0 EUR 1,747.00 €

1,747.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.