Skip to Content

ELISA Recombinant Scheffersomyces stipitis Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

https://www.anagnostics.com/web/image/product.template/156082/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) Uniprot NO.:A3LWK1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVIGAPKGHDRYRDPKTHQMTPALYRVRAPFFWKNTIGLAICTAIPLGVYMYTLHmLSK DEFGDIPIPPISDTELTKLKKEYEASKNQN Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Gene Names:Name:COA3 ORF Names:PICST_32500 Expression Region:1-90 Sequence Info:fµLl length protein

1,430.00 € 1430.0 EUR 1,430.00 €

1,430.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.