ELISA Recombinant Bat coronavirus HKU9 Envelope small membrane protein(E)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9) Uniprot NO.:A3EXG8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYDIVGTNNSILIANVLVLIIICLLVVIVGCALLLILQFVFGVCGFVFKFVCKPTILVYN KFRNESLLNEREELLCDNV Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Gene Names:Name:E Synonyms:sM ORF Names:4 Expression Region:1-79 Sequence Info:fµLl length protein