ELISA Recombinant Prochlorococcus marinus Cytochrome b6(petB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain MIT 9301) Uniprot NO.:A3PB49 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANSSSVYDWFQERLEIQDITDDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTQAYSSVSYLMTDVSFGWLIRSVHRWSASMMVLmLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVIGDFMVELLRGGESVGQ STLTRFYSLHTFVLPWSLAVFmLMHFLMIRKQGISGPL Protein Names:Recommended name: Cytochrome b6 Gene Names:Name:petB Ordered Locus Names:P9301_03511 Expression Region:1-218 Sequence Info:fµLl length protein