ELISA Recombinant Rhodobacter sphaeroides ATP synthase subunit c 1(atpE1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) Uniprot NO.:A3PN84 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFS FLIALLLMFAV Protein Names:Recommended name: ATP synthase subunit c 1 Alternative name(s): ATP synthase F(0) sector subunit c 1 F-type ATPase subunit c 1 Short name= F-ATPase subunit c 1 Lipid-binding protein 1 Gene Names:Name:atpE1 Ordered Locus Names:Rsph17029_2698 Expression Region:1-71 Sequence Info:fµLl length protein