Skip to Content

ELISA Recombinant Shewanella loihica Probable ubiquinone biosynthesis protein UbiB(ubiB)

https://www.anagnostics.com/web/image/product.template/156933/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shewanella loihica (strain ATCC BAA-1088 / PV-4) Uniprot NO.:A3QIE3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIKSMRRAYQVVKTVLQYGLDDLIPAKLKPWYFRLLRWSFFWLTNQHKDKVGGERLKLA MQELGPVYIKFGQmLSTRRDLLSDEWAEELAmLQDRVPPFDSAIARAQIEAELGAPIETY FDNFDDTPLASASISQVHTATLKSNGEEVVLKVLRPNVEEKVHADLLLMTQSAQVLETLL GHGNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSGALYIPKMYEEFCFTRLI VMERIYGVPVSDRAALEAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFVSTEHP EDPFYIGLDCGIMGTLTEQDKRYLAENFLAFFNRDYTRIAQLYIESGWVAADTDLVAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLESWMAEQMGPLGMAKKIKKQFPYWTDKLPELPELVYDNLKMGKNFVNS QNQLLDRYLKQQQKAHKSNYLLITSAVLVICGSILFSQNATLWASYACIGIGATLWLLGW RSRPKNRKF Protein Names:Recommended name: Probable ubiquinone biosynthesis protein UbiB Gene Names:Name:ubiB Ordered Locus Names:Shew_3375 Expression Region:1-549 Sequence Info:fµLl length protein

1,914.00 € 1914.0 EUR 1,914.00 €

1,914.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.