ELISA Recombinant Shewanella loihica Electron transport complex protein RnfA(rnfA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella loihica (strain ATCC BAA-1088 / PV-4) Uniprot NO.:A3QEN4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVD TYLLTPFDLSYLRTMAFILVIAVVVQFTEmLVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIESAIYGFGAAVGFSIVLILFSAMRERLAAADVPAPFKGGAIAMITAGLM SLAFMGFTGLVN Protein Names:Recommended name: Electron transport complex protein RnfA Gene Names:Name:rnfA Ordered Locus Names:Shew_2066 Expression Region:1-192 Sequence Info:fµLl length protein