ELISA Recombinant Populus trichocarpa NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa) Uniprot NO.:A4GYW8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MmLEYVLGLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGN IFSIFVISIAAAEAAIGPAIVSSIYRNRKSIRINQLNLLNK Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L Gene Names:Name:ndhE Ordered Locus Names:Poptr_cp081 Expression Region:1-101 Sequence Info:fµLl length protein