ELISA Recombinant Prosthecochloris vibrioformis Cobalamin synthase(cobS)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Prosthecochloris vibrioformis (strain DSM 265) (Chlorobium vibrioforme subsp. thiosµLfatophilum (strain DSM 265)) (Chlorobium phaeovibrioides (strain DSM 265))
Uniprot NO.:A4SEC9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:mLSGLVSAIRTLTIFSVPGKDAENFSSSLYWFPVVGAFLGTLLAACAWLPLSIGWSELAS AVVVVGGFIVSRGMHADGLADMADGFWGGGDRERTLSIMKDPTVGSFGALALLSLmLLKW VAILRLTEHGAFALIASGVLLGRLSQVLLAASLPYARKEGGTASGFVGGAGRTHAAVALA LSLMMTLPFFYRDPFLLFLLFGAALTAAALIGFLSMKKIGGITGDVLGAVSEVTELFVWL AAGVAFTAF
Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.-
Gene Names:Name:cobS Ordered Locus Names:Cvib_0823
Expression Region:1-249
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.