ELISA Recombinant Prosthecochloris vibrioformis NADH-quinone oxidoreductase subunit A(nuoA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prosthecochloris vibrioformis (strain DSM 265) (Chlorobium vibrioforme subsp. thiosµLfatophilum (strain DSM 265)) (Chlorobium phaeovibrioides (strain DSM 265))
Uniprot NO.:A4SF48
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQTLSEFGNVFVFFLLGVVFVAGGYLTARmLRPSRPNPVKTSTYECGEEAVGSAWVKFN IRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALVEALVFAGILILGLVYAWVKGDLDW VRPTPSVPKMPEMPASKSSSQRD
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:Cvib_1093
Expression Region:1-143
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.