ELISA Recombinant Prosthecochloris vibrioformis NADH-quinone oxidoreductase subunit A(nuoA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prosthecochloris vibrioformis (strain DSM 265) (Chlorobium vibrioforme subsp. thiosµLfatophilum (strain DSM 265)) (Chlorobium phaeovibrioides (strain DSM 265)) Uniprot NO.:A4SF48 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQTLSEFGNVFVFFLLGVVFVAGGYLTARmLRPSRPNPVKTSTYECGEEAVGSAWVKFN IRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALVEALVFAGILILGLVYAWVKGDLDW VRPTPSVPKMPEMPASKSSSQRD Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1 Gene Names:Name:nuoA Ordered Locus Names:Cvib_1093 Expression Region:1-143 Sequence Info:fµLl length protein