ELISA Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD(cobD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas stutzeri (strain A1501) Uniprot NO.:A4VJ38 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVFLSVIGALLLDALLGEPKRAHPLVAFGRLADRLEQHFNGAAGRGWRSHGVTAWCLAV LPLTLLAWLLSLLPGIGWLAEIVLLYLALGLRSLGEHALPVAQALWRHDLPEARRRVACI VSRDTSQLDEEGVARAATESVLENGSDAVFAALFWFIVAGAPGVVLYRLSNTLDAMWGYR NARFERFGWAAARIDDLLNYVPARLVAVTYALLGRTRRALRCWRTQAPLWDSPNAGPVMA AGAGALGVVLGGAAIYHGELHARPELGRGSAPQARHIEHALDLVWAGVGVWLLVLLFGGW LYA Protein Names:Recommended name: Cobalamin biosynthesis protein CobD Gene Names:Name:cobD Ordered Locus Names:PST_1295 Expression Region:1-303 Sequence Info:fµLl length protein