ELISA Recombinant Streptococcus suis UPF0397 protein SSU98_0390 (SSU98_0390)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus suis (strain 98HAH33) Uniprot NO.:A4VZK9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQSLLAVVFGPVVGFLVG FIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFEGKDILFFNLVQIAANV LAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTLLLVVYAKSQTKTGSLSK D Protein Names:Recommended name: UPF0397 protein SSU98_0390 Gene Names:Ordered Locus Names:SSU98_0390 Expression Region:1-181 Sequence Info:fµLl length protein