Skip to Content

ELISA Recombinant Rhodobacter sphaeroides Protease HtpX homolog(htpX)

https://www.anagnostics.com/web/image/product.template/153709/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) Uniprot NO.:A4WRW9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGYVRTGILMAVMTALFLGVGALIGGQSGAIIALIVAALMNLFTFWNSDKAVLSMHGAHE VDPRAAPDLHAMVRGLAERAGMPMPRLYLIETDQPNAFATGRNPENAAVAVTRGLLRALS PEEVAGVVAHELAHIKNRDTLLMTVTATFAGAISmLANFAFFFGGGSNQEGERPVGIVGT LALMILAPLAAGLVQMAISRSREYEADRIGAEICGRPLWLASALGKIEGLARRIDNTRAE RNPATAHMFIINPLHAMSHDRLFATHPNTANRIAALQAMAGAGVERSSMPRVPRRGPWR Protein Names:Recommended name: Protease HtpX homolog EC= 3.4.24.- Gene Names:Name:htpX Ordered Locus Names:Rsph17025_1232 Expression Region:1-299 Sequence Info:fµLl length protein

1,651.00 € 1651.0 EUR 1,651.00 €

1,651.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.