Skip to Content

ELISA Recombinant Pseudomonas stutzeri Na(+)-translocating NADH-quinone reductase subunit E

https://www.anagnostics.com/web/image/product.template/151231/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas stutzeri (strain A1501) Uniprot NO.:A4VMV0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEHYISLFVRAVFIENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIY TYLLKSGALAWAGLPEVDLSFLGLLSYIGVIAAIVQILEMTLDKYVPSLYNALGVFLPLI TVNCAIMGGTLFMVERDYNLGESVVYGMGSGLSWALAIALLAGIREKLKYSDVPDGLQGL GITFITIGLMSLGFMSFSGVQL Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit E Short name= Na(+)-NQR subunit E Short name= Na(+)-translocating NQR subunit E EC= 1.6.5.- Alternative name(s): NQR complex subunit E NQR-1 subunit E Gene Names:Name:nqrE Ordered Locus Names:PST_2651 Expression Region:1-202 Sequence Info:fµLl length protein

1,548.00 € 1548.0 EUR 1,548.00 €

1,548.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.