ELISA Recombinant Streptococcus suis UPF0397 protein SSU05_0404 (SSU05_0404)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus suis (strain 05ZYH33) Uniprot NO.:A4VTD2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQSLLAVVFGPVVGFLVG FIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFEGKDILFFNLVQIAANV LAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTLLLVVYAKSQTKTGSLSK D Protein Names:Recommended name: UPF0397 protein SSU05_0404 Gene Names:Ordered Locus Names:SSU05_0404 Expression Region:1-181 Sequence Info:fµLl length protein