ELISA Recombinant Pseudomonas mendocina Electron transport complex protein RnfG(rnfG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas mendocina (strain ymp) Uniprot NO.:A4XS49 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLPEISRSmLKNALVLGLFAIGTVGSVALLQQGTATRIAAAEREAQVRALAEILPAGSYD NHLLDNRIELNAPELGHRSPQSAYLALKGEQPSALILPVTAPDGYSGAIHLLVGIFADGR LAGVRVLGHRETPGLGDKIELAKSDWIRSFEGKSLSDPNEDGWAVKKDRGEFDQFAGATI TPRAVVKAVHGALRYFDKHRAQLLGLAEDEQ Protein Names:Recommended name: Electron transport complex protein RnfG Gene Names:Name:rnfG Ordered Locus Names:Pmen_1400 Expression Region:1-211 Sequence Info:fµLl length protein