ELISA Recombinant Shewanella putrefaciens UPF0114 protein Sputcn32_0673 (Sputcn32_0673)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) Uniprot NO.:A4Y370 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHVLPIIFEMREVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMNVENISNDKIMWYLLIHITFVLSAFAMGYLDKITRK Protein Names:Recommended name: UPF0114 protein Sputcn32_0673 Gene Names:Ordered Locus Names:Sputcn32_0673 Expression Region:1-162 Sequence Info:fµLl length protein