ELISA Recombinant Vibrio cholerae serotype O1 UPF0114 protein VC0395_A2587-VC395_0240 (VC0395_A2587, VC395_0240)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) Uniprot NO.:A5F419 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERLIEKLLYSSRWIMAPIYLGLSLLLLALGIKFFQEIFHLLPNIFTIKEVDLILVALSL IDVSLVGGLIVMVMFSGYENFVSKLDVDESEDKLGWLGKLDTSSLKNKVSASIVAISSIH LLKVFMNTENIESDKIKWYLLLHITFVVSAFAMGYLDKITKK Protein Names:Recommended name: UPF0114 protein VC0395_A2587/VC395_0240 Gene Names:Ordered Locus Names:VC0395_A2587, VC395_0240 Expression Region:1-162 Sequence Info:fµLl length protein