ELISA Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC0395_A0854-VC395_1352 (VC0395_A0854, VC395_1352)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) Uniprot NO.:A5F1V9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG Protein Names:Recommended name: UPF0299 membrane protein VC0395_A0854/VC395_1352 Gene Names:Ordered Locus Names:VC0395_A0854, VC395_1352 Expression Region:1-129 Sequence Info:fµLl length protein