ELISA Recombinant Vibrio cholerae serotype O1 UPF0761 membrane protein VC0395_A2314-VC395_2854 (VC0395_A2314, VC395_2854)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) Uniprot NO.:A5F4Q8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPmLTVLLSILSSF ALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAImLISNID KNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNL FLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAmLGALIAAILFELSKKGFAAYITQFPSYQ LIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDmLHFAPLPKNEKE Protein Names:Recommended name: UPF0761 membrane protein VC0395_A2314/VC395_2854 Gene Names:Ordered Locus Names:VC0395_A2314, VC395_2854 Expression Region:1-297 Sequence Info:fµLl length protein