ELISA Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsA(ccsA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechococcus sp. (strain WH7803) Uniprot NO.:A5GLB4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGSFDLQSITSEPVLLLGLAAFALLLTALPWCFWAVSNGRSSSGVRSLLGLSNLLLTAQL VLRWWQSGHFPISNLYESLCFLAWACTLTQLLVERQWPSPLVAASATPMGLGCIAFASFA LPDQLQQASPLVPALRSSWLVMHVSVIMVSYAALLVGSLLSVAVLMTDRGQQLELRSSSI GSGAFRKAVSITGETSAVGVQAAPELQLSSIDFSRSEQLDSLSYRTITVGFLLLTVGIIS GAVWANEAWGSWWSWDPKETWALICWLVYAAYLHTRLSRGWQGRRPAMVASLGLVVIVVC YIGVNLLGIGLHSYGWFFDA Protein Names:Recommended name: Cytochrome c biogenesis protein CcsA Gene Names:Name:ccsA Ordered Locus Names:SynWH7803_1303 Expression Region:1-320 Sequence Info:fµLl length protein